| Product Name | IL37 Human |
|---|---|
| Product description | Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK |
| SwissProt ID | Q9NZH6 |
| Storage Instructions | Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4. |
Data sheet for OM296374