All products Growth Factors Activin-A Human Plant-Active

Activin-A Human Plant-Active

Catalog Number:OM300725

Product Profile

Product Name Activin-A Human Plant-Active
Product description
Active form Activin-A Human Recombinant produced in Plant is a homodimeric, glycosylated, polypeptide chain containing 2 x 116 amino acids and having a molecular weight of 27.4kDa.

Target Information

Source Nicotiana benthamiana.
Sequence Similarities HHHHHHGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSG

Database Links

SwissProt ID P08476

Additional Information

Storage Instructions For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended.
Storage Buffer Active form Activin-A was lyophilized from a concentrated 1mg/ml protein solution containing 50mM Tris-HCl pH-7.4
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM300725
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.