Eotaxin 2 Human

Product Profile

Product Name	Eotaxin 2 Human
Product description	CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.

Target Information

Source	Escherichia Coli.
Sequence Similarities	VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG

Database Links

SwissProt ID	O00175

Additional Information

Storage Instructions	Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Storage Buffer	The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

• Question type：
• Enter the charactors： Generate another
• Submit the question

• Data sheet for OM301601