FSH Human

Catalog Number：OM300363

Product Profile

Product Name FSH Human
Product description 
FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total Mw of 38kDa. FSH human recombinant is purified by proprietary chromatographic techniques.

Target Information

Source HEK293
Sequence Similarities FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR

Database Links

SwissProt ID P01225

Additional Information

Storage Instructions Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Storage Buffer The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

Submit an review for OM300363
Submit an review for OM300363
  • Catalog Number: OM300363
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week

  • Quantity:
    - +
  • Shipping to (Please select)
Add to cart
Add to Wishlist
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.
PRODUCT CATEGORIES
Primary antibodies Secondary antibodies Tags antibodies Flow cytometry antibodies
SUPPORT
Catalogs Newsletter Order Online Buying FAQs Distributor
COMPANY
Profile Strategy Careers
CONTACT
Contact us

2013 © Omnimabs , All Rights Reserved.