GMFB Human

Catalog Number:OM297626

Product Profile

Product Name GMFB Human
Product description
Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa.

Target Information

Source Escherichia Coli.
Sequence Similarities SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPD

Database Links

SwissProt ID P60983

Additional Information

Storage Instructions Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C.
Storage Buffer The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM297626
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.