-
United States
- Call us: +213 / 3753998
- Afghanistan
- Albania
- Algeria
- Andorra
- Angola
- Argentina
- Armenia
- Australia
- Austria
- Azerbaijan
- Bahrain
- Bangladesh
- Barbados
- Belarus
- Belgium
- Belize
- Benin
- Bhutan
- Bolivia
- Bosnia and Herzegovina
- Brazil
- Brunei
- Bulgaria
- Cambodia
- Cameroon
- Canada
- Cape Verde
- Central African Republic
- Chad
- Chile
- China
- Comoros
- Costa Rica
- Croatia
- Cuba
- Cyprus
- Czech Republic
- Denmark
- Djibouti
- Ecuador
- El Salvador
- Equatorial Guinea
- Eritrea
- Estonia
- Ethiopia
- Fiji
- Finland
- France
- Gabon
- Gambia, The
- Georgia
- Germany
- Ghana
- Greece
- Grenada
- Guatemala
- Guyana
- Haiti
- Honduras
- Hungary
- Iceland
- India
- Indonesia
- Iran
- Iraq
- Ireland
- Israel
- Italy
- Jamaica
- Japan
- Jordan
- Kazakhstan
- Kenya
- Kiribati
- Korea, South
- Kuwait
- Latvia
- Lebanon
- Liberia
- Libya
- Liechtenstein
- Lithuania
- Luxembourg
- Macedonia
- Malawi
- Malaysia
- Maldives
- Mali
- Malta
- Marshall Islands
- Mauritania
- Mauritius
- Mexico
- Micronesia
- Moldova
- Monaco
- Morocco
- Mozambique
- Myanmar
- Nepa
- Netherlands
- New Zealand
- Nicaragua
- Niger
- Nigeria
- Norway
- Oman
- Pakistan
- Palau
- Panama
- Papua New Guinea
- Paraguay
- Peru
- Philippines
- Poland
- Portugal
- Qatar
- Romania
- Russia
- Saint Kitts and Nevis
- Samoa
- Sao Tome and Principe
- Senegal
- Seychelles
- Singapore
- Slovenia
- Solomon Islands
- Somalia
- South Africa
- Spain
- Sri Lanka
- Sudan
- Suriname
- Swaziland
- Sweden
- Switzerland
- Syria
- Taiwan
- Tajikistan
- Tanzania
- Thailand
- The Republic of Colombia
- Togo
- Tonga
- Tunisia
- Turkey
- Tuvalu
- Uganda
- Ukraine
- United Kingdom
- United States
- Uruguay
- Venezuela
- Vietnam
- Yemen
- Zambia
- Zimbabwe
All products
Cytokines IL37 Human
Product Profile
| Product Name | IL37 Human |
|---|---|
| Product description |
|
Target Information
| Source | Escherichia Coli. |
|---|---|
| Sequence Similarities | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEK |
Database Links
| SwissProt ID | Q9NZH6 |
|---|
Additional Information
| Storage Instructions | Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. |
|---|---|
| Storage Buffer | IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4. |
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.
-
- ASSAY KITS
-
- SERUM
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.
2013 © Omnimabs , All Rights Reserved.