NRG1 Human

Catalog Number:OM297570

Product Profile

Product Name NRG1 Human

Target Information

Source Escherichia Coli.
Sequence Similarities SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.

Database Links

SwissProt ID Q02297

Additional Information

Storage Instructions Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.
Storage Buffer Lyophilized from a 0.2µm filtered solution in PBS, pH 7.4.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM297570
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.