| Product Name | LR3 IGF1 Human |
|---|---|
| Product description | The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals. |
| Source | Escherichia Coli. |
| Sequence Similarities | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA. |
| Storage Instructions | Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS. |
Data sheet for OM301241