| Product Name | Noggin Mouse |
|---|---|
| Product description | Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa). |
| Source | Escherichia Coli. |
| Sequence Similarities | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD |
| SwissProt ID | P97466 |
| Storage Instructions | Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA. |
Data sheet for OM301247