| Product Name | CDH1 Human, HEK |
|---|---|
| Product description | E-Cadherin Human Recombinant produced in HEK cells is a secreted protein with the sequence of Human E-Cadherin (amino acids Asp155-Ile707) and fused to a 6xHis tag at the C-terminus. |
| Source | HEK cells. |
| Sequence Similarities | DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWL |
| Storage Instructions | Lyophilized E-Cadherin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CDH1 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The CDH1 protein was lyophilized from a 0.2µm filtered solution in PBS, pH7.4. |
Data sheet for OM303768