Application
Western Blot: Galactosidase alpha Antibody - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: TonsilApplication
Western Blot: Galactosidase alpha Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).Application
Immunohistochemistry-Paraffin: Galactosidase alpha Antibody - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.| Product Name | Galactosidase alpha antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Galactosidase alphaThis gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. [provided by RefSeq, Jul 2008] |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVA MINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGT |
| Clonality | Polyclonal |
|---|---|
| Isotype | IgG |
| Host Species | Rabbit |
| Tested Applications | IHCIHC-PWB |
| WB: 1:100 - 1:500. IHC: 1:10 - 1:500. IHC-P: 1:500 - 1: 1000: |
|
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | GALA GLA galactosidase alpha |
|---|---|
| Target | Galactosidase alpha |
| Tissue Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Application
Western Blot: Galactosidase alpha Antibody - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Application
Western Blot: Galactosidase alpha Antibody - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
Application
Immunohistochemistry-Paraffin: Galactosidase alpha Antibody - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.| Application Notes | WB: 1:100 - 1:500. IHC: 1:10 - 1:500. IHC-P: 1:500 - 1: 1000: |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Storage Buffer | PBS, pH 7.2, containing 40% glycerol and 0.02% Sodium Azide |
