Application
Anti-KV1.3 - Western blot analysis of rat brain membranes: 1. Anti-Kv1.3 antibody, (1:200) 2. Anti-Kv1.3 antibody, preincubated with the control peptide antigen.| Product Name | Kv1.3 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv1.3Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1 |
| Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3 (Accession P22001). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Isotype | IgG |
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIPWB |
| ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | potassium voltage-gated channel shaker-related subfamily member 3 PCN3 HGK5 HUKIII HLK3 HPCN3 MK3 KCNA3 KV1.3 |
|---|---|
| Target | Kv1.3 |
Application
Anti-KV1.3 - Western blot analysis of rat brain membranes: 1. Anti-Kv1.3 antibody, (1:200) 2. Anti-Kv1.3 antibody, preincubated with the control peptide antigen.| Application Notes | ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3. |
