Application
WB analysis of rat brain membranes using Kv1.4 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Product Name | Kv1.4 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv1.4voltage-gated K+ channel; responsible for potassium permeability in excitable membranes [RGD, Feb 2006] |
| Immunogen | GST fusion protein with sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEE KCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCWB |
| ICC/IF:1:200~1:500 IHC:1:50~1:200 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | potassium voltage-gated channel shaker-related subfamily member 4 Kv4 Kcna4 KCHAN RK3 RHK1 |
|---|---|
| Target | Kv1.4 |
Application
WB analysis of rat brain membranes using Kv1.4 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Application Notes | ICC/IF:1:200~1:500 IHC:1:50~1:200 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose and 0.025% NaN3. |
