Application
WB analysis of rat brain membranes using Maxi Potassium channel alpha antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Product Name | Maxi Potassium channel alpha antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Maxi Potassium channel alpha |
| Immunogen | GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC, corresponding to residues 1097-1196 of mouse KCa1.1 variant 2 (Accession Q08460-2). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIPWB |
| ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|
| Species Reactivity | MouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | MBK1 Kv1.1 AI840627 Kcna1 Shak Kca1-1 Mk-1 potassium voltage-gated channel shaker-related subfamily member 1 mceph |
|---|---|
| Target | Maxi Potassium channel alpha |
Application
WB analysis of rat brain membranes using Maxi Potassium channel alpha antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Application Notes | ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS) pH 7.4, 1% BSA and 0.025% NaN3. |
