| Product Name | IL17E Mouse |
|---|---|
| Product description | Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS |
| SwissProt ID | Q8VHH8 |
| Storage Instructions | Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
