| Product Name | IL17F Mouse |
|---|---|
| Product description | IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP |
| SwissProt ID | Q7TNI7 |
| Storage Instructions | Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
