| Product Name | IL 19 Mouse |
|---|---|
| Product description | Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL |
| SwissProt ID | Q8CJ70 |
| Storage Instructions | Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Lyophilized from a sterile filtered aqueous solution containing 5mM Na |
