| Product Name | IL 13 Human |
|---|---|
| Product description | Interleukin-13 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS |
| SwissProt ID | P35225 |
| Storage Instructions | Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The protein (1mg/ml) was lyophilized with 1xPBS pH-7.2 & 5% trehalose. |
