| Product Name | IL 1 beta Rat |
|---|---|
| Product description | Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF |
| SwissProt ID | Q63264 |
| Storage Instructions | Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. |
