| Product Name | IL 1 beta Human, HEK |
|---|---|
| Product description | Interleukin-1 beta Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 18-25kDa due to glycosylation. |
| Purification | Affinity purified |
| Source | HEK. |
| Sequence Similarities | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIP |
| SwissProt ID | P01584 |
| Storage Instructions | Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The IL-1 beta was lyophilized from 1mg/ml in 1xPBS. |
