| Product Name | BMP 7 Human, Plant |
|---|---|
| Product description | Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. |
| Source | Nicotiana benthamiana. |
| Sequence Similarities | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN |
| SwissProt ID | P18075 |
| Storage Instructions | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
