| Product Name | BNP Human |
|---|---|
| Product description | B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH. |
| SwissProt ID | P16860 |
| Storage Instructions | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. |
