| Product Name | TNFR2 Human, His |
|---|---|
| Product description | TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. |
| Source | Escherichia Coli. |
| Sequence Similarities | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWV |
| SwissProt ID | P20333 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. |
| Storage Buffer | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
