| Product Name | TNFR Human, His |
|---|---|
| Product description | TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQ |
| SwissProt ID | P19438 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. |
| Storage Buffer | TNFR His Tag protein is supplied in 1xPBS, 50% glycerol. |
