| Product Name | TNF a Human, HEK |
|---|---|
| Product description | TNF-a Human Recombinant produced in HEK cells is a glycosylated non-disulfide linked homotrimer, containing 157 and having total Mw of 17kDa. |
| Source | HEK. |
| Sequence Similarities | VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLI |
| SwissProt ID | P01375 |
| Storage Instructions | Lyophilized TNF-a although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TNF-a should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The TNF-a protein was lyophilized from 1mg/ml in 1xPBS. |
