| Product Name | EBI3 Human |
|---|---|
| Product description | EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF |
| SwissProt ID | Q14213 |
| Storage Instructions | Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Storage Buffer | EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol. |
