| Product Name | TFF1 Human |
|---|---|
| Product description | TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY |
| SwissProt ID | P04155 |
| Storage Instructions | Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl. |
