| Product Name | ProNGF Human |
|---|---|
| Product description | Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI |
| SwissProt ID | P01138 |
| Storage Instructions | Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | ProNGF was lyophilized from a 0.2 µM filtered solution of 20mM PB and 250mM NaCl pH 7.2. |
