| Product Name | CNTF Rat |
|---|---|
| Product description | CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNI |
| SwissProt ID | P20294 |
| Storage Instructions | Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below |
| Storage Buffer | Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. |
