| Product Name | PLA2G7 Human, HEK |
|---|---|
| Product description | Recombinant Human PLA2G7 produced in HEK293 cells is a polypeptide chain (22-441 a.a), fused to an 8 amino acid His-tag at C-terminus, containing a total of 428 amino acids. |
| Source | HEK293 cells. |
| Sequence Similarities | FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPS |
| SwissProt ID | Q13093 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. |
| Storage Buffer | The PLA2G7 is supplied as a 0.2µm filtered solution in 20mM HAc-NaCl, 150mM NaCl and 10% Glycerol, pH 4.5. |
