| Product Name | Chitodextrinase |
|---|---|
| Product description | Chitodextrinase Clostridium Botulinum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 590 amino acids and having a molecular mass of 66.9kDa. The Chitodextrinase is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | HMRGSGSHHHHHHKEKFKTTKIKNSSELNRKLVGYFPEWAYSSEAQGYFNVTD |
| Storage Instructions | Lyophilized Chitodextrinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitodextrinase should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Chitodextrinase lyophilized from a 0.2µm filtered concentrated solution in PBS. |
