| Product Name | FSH Human |
|---|---|
| Product description | FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total Mw of 38kDa. FSH human recombinant is purified by proprietary chromatographic techniques. |
| Source | HEK293 |
| Sequence Similarities | FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLR |
| SwissProt ID | P01225 |
| Storage Instructions | Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
| Storage Buffer | The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS. |
