| Product Name | Activin-A Human Plant-Active |
|---|---|
| Product description | Active form Activin-A Human Recombinant produced in Plant is a homodimeric, glycosylated, polypeptide chain containing 2 x 116 amino acids and having a molecular weight of 27.4kDa. |
| Source | Nicotiana benthamiana. |
| Sequence Similarities | HHHHHHGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSG |
| SwissProt ID | P08476 |
| Storage Instructions | For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended. |
| Storage Buffer | Active form Activin-A was lyophilized from a concentrated 1mg/ml protein solution containing 50mM Tris-HCl pH-7.4 |
