| Product Name | FGF 23 Human, His |
|---|---|
| Product description | Fibroblast Growth Factor-23 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARN |
| SwissProt ID | Q9GZV9 |
| Storage Instructions | Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution. |
