| Product Name | GHBP Human |
|---|---|
| Product description | Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | AFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTK |
| SwissProt ID | P10912 |
| Storage Instructions | Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | GHBP was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3. |
