| Product Name | HGF Human |
|---|---|
| Product description | Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa. |
| Source | Insect cells. |
| Sequence Similarities | QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK |
| SwissProt ID | P14210 |
| Storage Instructions | Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid. |
