| Product Name | HGF B Human |
|---|---|
| Product description | HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. |
| Source | Escherichia Coli. |
| Sequence Similarities | VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR |
| SwissProt ID | P14210 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. |
