| Product Name | HGF A Human |
|---|---|
| Product description | HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag. |
| Source | Escherichia Coli. |
| Sequence Similarities | QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN |
| SwissProt ID | P14210 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. |
| Storage Buffer | HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol. |
