| Product Name | MIF Human His C |
|---|---|
| Product description | MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPC |
| SwissProt ID | P14174 |
| Storage Instructions | Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. |
