| Product Name | MIF Human, Active |
|---|---|
| Product description | MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM |
| SwissProt ID | P14174 |
| Storage Instructions | Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5. |
