| Product Name | SPP1 Human, HEK |
|---|---|
| Product description | Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The actual molecular mass may be approximately 60-65kDa in SDS-PAGE under reducing conditions due to glycosylation). |
| Source | HEK293 cells. |
| Sequence Similarities | IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL |
| SwissProt ID | P10451 |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. |
| Storage Buffer | Osteopontin was lyophilized from a 0.2µM filtered solution of 20mM PB and 150mM NaCl, pH 7.2. |
