| Product Name | VEGFC Human HEK |
|---|---|
| Product description | VEGFC Human Recombinant produced by transfected human cells is a single polypeptide chain containing 204 amino acids (32-227). VEGFC is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. |
| Source | HEK293 cells. |
| Sequence Similarities | FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYK |
| SwissProt ID | P49767 |
| Storage Instructions | Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | VEGFC was lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2. |
