| Product Name | VEGF C Rat |
|---|---|
| Product description | Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions. |
| Source | Sf9, Insect Cells. |
| Sequence Similarities | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSII |
| SwissProt ID | P16612 |
| Storage Instructions | Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer. |
