| Product Name | VEGF (121 a.a.) Human, Sf9 |
|---|---|
| Product description | Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa. |
| Source | Sf9, Insect Cells. |
| Sequence Similarities | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR. |
| SwissProt ID | P15692 |
| Storage Instructions | Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The protein was lyophilized from a solution containing 50mM acetic acid. |
