| Product Name | TGFB2 Human |
|---|---|
| Product description | TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. |
| Source | Nicotiana benthamiana. |
| Sequence Similarities | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH |
| SwissProt ID | P61812 |
| Storage Instructions | Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Storage Buffer | Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4. |
