| Product Name | HCC 1 Human |
|---|---|
| Product description | HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHS |
| SwissProt ID | Q16627 |
| Storage Instructions | Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl. |
