| Product Name | I TAC Human |
|---|---|
| Product description | I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF. |
| SwissProt ID | O14625 |
| Storage Instructions | Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
| Storage Buffer | Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl. |
