| Product Name | MCP 4 Human |
|---|---|
| Product description | Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAV |
| SwissProt ID | Q99616 |
| Storage Instructions | Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
| Storage Buffer | The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl. |
