| Product Name | Tpc1808 Rat |
|---|---|
| Product description | Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS |
| Storage Instructions | Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. |
| Storage Buffer | The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |
