| Product Name | RORC Human |
|---|---|
| Product description | RAR-Related Orphan Receptor C Human Recombinant produced in E.Coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag. |
| Source | Escherichia Coli. |
| Sequence Similarities | MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAY |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. |
| Storage Buffer | RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. |
